Saturday, February 10, 2018

Oral cavity care- Problems related with gums, teeth and tongue- it’s management with #Ayurveda


Views shared by several Ayurveda professionals and non-Ayurveda people in discussion group:
Disclaimer:
All views shared here are only for knowledge. This information doesn’t have any scientific validation. Various doctors and non-medicos have shared their views and experiences in this discussion. Please do not try any of the suggestions described here, without prior consult from your regular, qualified doctor. Dr. Prerak Shah and no other person is responsible for any unwanted effects, side effects or contra-indications in your health. Thank you.
(Any ayurveda or medical doctor, If you like this activity, and wants to be a part of this chat discussion on whatsapp, please send in your request by email to admin@ayulink.com Thank you.)
<><><><><><><><><><><><><><><><><><><><><><><><><><><><> 
Next topic for discussion: Oral cavity care- Problems related with gums, teeth and tongue- it’s management with #Ayurveda
Dr. Mrugeshkumar Patel: Borsalli nu datan to strengthen the gum; erimidadi tail gandush dharan 15ml-15ml for teeth tongue & oral cavities care.
Vd. Pritam Bharat Veer: Gandhak Rasayan , Praval , Trifala guggul with warm water , simple til tail warm gandush dharan. Smile gel for local application in ulcers. Dantmanjan very good option for vaat prakop in teeth.
**********************************************


Ayulink offers
Chemical Free Beauty Treatments
We recommend enjoying our “Body-polishing”
(For exfoliates and hydrates the skin, leaving it smooth & soft…)

***********************************************

Ayulink: Any suggestion for painful gums or bleeding gums?
Dr. Vishva Joshi: Guduchi stem danthdhavan for pyoria. After food,morning and night 2 minute gum massage with finger.
Croatia Branko Markovic: What about receding gums?
Dr. Vishva Joshi: If patient on phenytoin cause gingivitis so nidanparivarjan. For cavity any good medicine plz?
Dr. Mrugeshkumar Patel: G-32gum paint , G-32Tab for painful gum / bleeding gum
Croatia Branko Markovic: For removing dental plaque sodium bicarbonate - baking soda is very effective. Just adding little bit to tooth brush or on finger and apply 2-3 times per week. Then break for 1 month. Also very effective for whitening teeth.
Gary Yuen: Are there any herbs that would work? Besides neem sticks, there's one study mentioning chewing sticks of miswak/pilu/arak (salvadora persica or salvadora oleides), orange (Citrus sinensis), and lime (Citrus aurantifolia). Does anyone have experience with traditional formulas? Caraka mentions only one that says is effective for all tooth and mouth problems including cavities and tartar. khadirādi gaṭika et khadirādi taila (cikitsasthana 26.199-207). Anyone try it or know of others?
 Vd. Sureshbhai Chavda:
Bad Breath-Foul breath can be very embarrassing and is mostly a result of indigestion.To take care of indigestion, chewing a clove after every meal for some days improves the digestion, takes care of acidity and cures bad breadth.
Cold sores, or mouth ulcers- This is due to increased Pitta.
According to the Shalyatantra and Shalakyatantra (one of the branches of Ayurveda), 65 varieties of oral diseases can arise in seven anatomic locations-eight on the lips, 15 on the alveolar margin, eight in connection with the teeth, five on the tongue, nine on the palate, 17 in the oropharynx and three in a generalized form.
172: Painful gums occur mainly due to deficiency of vit-C and Ayurveda consider it as vitiated pitta and kapha doshas. And other reasons for painful gums might be due to drida danta dhavana(brushing too hard) or due to wrong flossing. Treatment : purification of the body by emesis(vamana) and mild purgation (virechana) is ideal as they mitigate the kapha and pitta doshas.
Dr. Vasupradha R: Are all oral disorders related to GI Track? Either with nidanam or upadravam?
Ayulink: Can't say all, but many of oral problems have connection with GI.
Dr. Vasupradha R: I have observed a person constantly complaining of oral dryness i.e. always the tongue sticks to the palate and ill difficult to start speaking. I tried with just tila taila kavalam. When the patient is doing kavalam, there's absolutely no problem But when kavalam  is not done for even a day, the problem recurs. Can anybody guide me in this?
Ayulink: what is the underlying factor / condition of oral dryness?  Like  the sensation of dry mouth, the possibility of depression as an underlying factor should be considered.Dry mouth can occur when the glands in the mouth that make saliva are not working properly. Some common causes include nervousness, stress, certain medications, aging, cancer therapy (radiation/chemotherapy), and autoimmune disorders like Sjorgren’s syndrome, smoking and methamphetamine use. Sjogren’s syndrome is a chronic autoimmune disease in which a person’s white blood cells attack their moisture-producing glands, the eyes and salivary glands in the mouth. Sjorgren’s can cause dry eyes, dry mouth, fatigue and joint pain. It can also cause dysfunction on other organs, such as the kidneys, gastrointestinal system, blood vessels, lungs, liver, pancreas and central nervous system. Oral issues that occur are dry mouth, swollen salivary glands, increase in tooth decay and gum disease. Conduct good oral hygiene procedures and see your dentist for regular professional cleanings.
Dr. Vasupradha R: The patient is 53 years young. I also advised the patient for dental check up. But no abnormality was detected. There's no mental issues for the patient. Currently patient s taking Rasnapanchakam Kashayam with  Sahacharadhi tailam. Partharishtam with kseerabala.  Above medicines for a month. Patient has  vatakantakam, Sira granthi, Post menopausal issues and painful  knee joints.
Ayulink: As the patient is 53 years old, more chances of depression from my thoughts
Dr. Vasupradha R: With these medicines patient is 90% alright now
 Ayulink: Try, give some brahmi or anti -stress medicines.
Dr. Vasupradha R: Yes, tried that too. Brahmi vati 2 bid For a month, But when there's intake of medicines, there's no problem.
Ayulink: I wish,  that will work...otherwise as u r doing gandush is the best.
Dr. Vasupradha R: But for how many days Sir? This kavalam s going on for almost 40 days Or can we change the tailam?
Ayulink: as a part of dincharya....everyday early morning, after brushing the teeth...one gandusha. but we need to find out underlying causes for dryness in mouth...
Dr. Vasupradha R: Yes, this is the area which I'm not understanding
Dr. Navneeth Krishnan: Mam since she is above 50yr, mostly she will be on menopause and there can be estrogen deficency.usually estrogen deficency cause dryness.can the reason be severe estrogen deficency??
Dr. Vasupradha R: How to identify this cause sir? She menopaused at the age of 51
Dr. Navneeth Krishnan: Yes mam this is so difficult to know, but there are some other things associated like dryness in skin along with itching, vaginal dryness, hot flushes etc to know whether there is estrogen deficiency also lab test like fsh(increased)and estradiol (Decreases) also help us diagnose. Tsh also to be checked, cos hypothyroidism also cause dryness.
Dr. Vasupradha R: I'll advise for these tests. And if that's not the nidanam, then? Sry to ask too many questions, but this case s really confusing for me...
Dr. Navneeth Krishnan: Mam y u opted tila taila for kavala ?is there any special reason
Ayulink:  I think sesame oil considered best amongst all oil.
Dr. Vasupradha R: Yea, first thing is that I thought let me start with simple thila tailam. Second thing s only that was available with the patient.
Dr. Navneeth Krishnan: Yes that's true sir, y I asked the question is even though it has snigdha Guna it is having usna Virya(but sita externaly) and is vata kapha samaka
Ayulink: any suggestion for sub-mucus fibrosis for tobacco eater?
Dr. Sahaj Shah: Triphla kwath gandush
Ayulink: It is like condition that pt can not open the mouth (hardly 1 finger)
Entering any solid food in mouth is difficult.
423: Sneh Gandush and kaval dharan is useful. As it give results in every fibrosis
Dr. Sahaj Shah: Ask the pt to take the kwath with straw. It will be convenient
423: Can also suggest some facial muscle exercises. Which will help to open the mouth gradually
Dr. Sahaj Shah: Go for biopsy too if possible
Ayulink: Yes, biopsy done.not detected any malignancy.
Dr. Sahaj Shah: Ok. Straw method can b given a try. Orally Panchtikta ghrut 1 tsp bd.
Vd. Khyati Jariwala: Gandush of coconut oil in plaque is very effective
Dr. Ravi Goyal: Kala til ko chabaye jisse teeth or gums ka snehan hoga
Dr. Mahendra Ther: Oil pulling therapy is the best treatment for oral related diseases.
Mona Patel : Castrol oil + kapoor mix krke rat ko gums pe massage kre.
Dr. Daisy Kanabar: Lavang or eladi vati esa mukhdurgandh (bad smell in mouth) k liye use kr skte h....
Dr. Sharmila Kulkarni: Irimedadi tailam for gum massage is very useful
Vd. Pritam Bharat Veer: Til tail also good for gandush. Triphala guggul for internal use. As it has vran shodhan and ropan both actions.
Ayulink: Any suggestion for painful gums or bleeding gums?
Vd. Pritam Bharat Veer: Dantmanjan. As it contains all vran sandhanak , vat har dravyas ,for bleeding gum we Add arjun sal ,khadir , lodhra like dravyas.
Mona Patel: Kapor + castrol oil week gum and hilte dant ko chipka deta he.. Too much power in this.
Shail H. Bhavsar: In mukha paka,gandush of triphala kwath is very benificial.
Dr Ekta patel: In which dose, up to what duration?
Ami Keyur shah: Any toothpaste recommendations for daily use? To help with gum receding? Specially with braces? For adults and kids?
Dr. Amrish A Shah: Caster oil Karpoor- Lavang tail is Very Effect.
Vd. Pritam Bharat Veer: No toothpaste only dantmanjan. Which kapur you use?
Dr. Amrish A Shah: Bhimseni karpoor10gm Lavang oil 10gm Caster oil 100gm
Vd. Pritam Bharat Veer: How long it can be preserved? Duration Will also apply the remedy.
Dr. Amrish A Shah: Yes. Duration 1year no preservation I use 42 Years in myself and my pt.
Dr. V B. Maheshwari: Is there any role of sfatika Bhasma in white teeth. If yes so should we use this alone or with any other combination.
Anoop S. Anand: Kavala or Gandoosh should help
 Vd. Dhruti Nirav Bhatt: Dashansanskar churna mix with Irimedadi oil and massage every day . Saindhav and musterd oil mixture for brushing
Ami Keyur shah: In USA we don’t get dant manjan. What is the solution? We have castor oil and Kapoor And laving oil
 907: Causes of dry mouth include: Side effect of certain medications . Dry mouth is a common side effect of many prescription and nonprescription drugs, including drugs used to treat depression,anxiety, pain, allergies and cold (antihistamines  and decongestants), obesity,  acne,  epilepsy,  hypertension(diuretics),  diarrhea,  nausea,  psychotic disorders, urinary incontinence,  asthma (certain - bronchodilators),  and Parkinson's disease. Dry mouth can also be a side effect of muscle relaxants and sedatives.Side effect of certain diseases and infections. Dry mouth can be a side effect of medical conditions, including Sjögren's syndrome, HIV/AIDS, Alzheimer'sdisease, diabetes, anemia, cystic fibrosis,rheumatoid arthritis, hypertension,Parkinson's disease, stroke, and mumps.Side effect of certain medical treatments.Damage to the salivary glands, the glands that make saliva, can reduce the amount of saliva produced. For example, the damage could stem from radiation to the head and neck, and chemotherapy treatments, forcancer. Nerve damage . Dry mouth can be a result of nerve damage to the head and neck area from an injury or surgery. Dehydration . Conditions that lead to dehydration, such as fever, excessive sweating, vomiting, diarrhea, blood loss, and burns can cause dry mouth. Surgical removal of the salivary glands. Lifestyle. Smoking or chewing tobacco can affect how much saliva you make and aggravate dry mouth. Breathing with your mouth open a lot can also contribute to the problem.
Vd. Hemant k shah: 1stof all vibandh. Stress induce life style, Adharniya veg ne dharan karava. Serum Electrolyte  in balance.
767: Black dry grapes best result for dryness of mouth.
Vd. Dhruti Nirav Bhatt: Dates, Amala, Black dry grapes, Yastimadhu and sharkara mixture and make tablets .Keep in mouth. its very good. If patient has diabetes then Amla ,dry black grapes also keep in mouth it's also beneficial.
Croatia Branko Markovic: What about white grapes? Dry black are very difficult to find here.
Dr. Nehal Shah: Fennel seeds one tsp + coriander seeds one tsp + 1 cup water mix in earthen pot. Let it infused for a night. Strain it next morning. One can take once a day or twice a day.
Ami Keyur shah: Are those tablets—Dates,Amla,dry grapes,Yasthimadhu available in the market???
Dr. Ravi Goyal: Haldi +lavan+ sarso ka tel and one more i personally use the leaves or mengo tree cheew and use as teath cleaner For the whitening of teeth.
Dr. Devesh Kumar: Khadiradi vati and ganusha with dashmool taila
Vd. Hardik bhatt: Sesame oil gandush good for dryness of mouth.
Vd. Dhruti Nirav Bhatt: Mouth ulcers are there then Panchvalkal Kwath gargle and Khadi radi vati gives good results. One of my patient was suffering with  mouth ulcers from 6days and took Allopathic medicines but no results. I gave him Erandbhrist Harde for laxative and Only Kherchhal(Khadirbark) powder for Gargle .And tremendous result within 2days.
Dr. Sujata Vaidya: Glycerine coating in mouth on ulcers works very well.
Dr. Bhavini Raja: In mouth ulcers. Tab khadiradi vati And tab Nisha amalaki works well.
Vd Sandeep Kumar: Chewing of bakul leaves also helps in mouth ulcer and gum pain. Roasted hing application works in gum pain induced by cavity.
Ayulink: Did you mean to fill the cavity by roasted hing?
Vd Sandeep Kumar: Amrut Dhara application also works well in tooth pain
Vd Sandeep Kumar: Yes sir
Pratisaran of  tankan (suhaga)  + honey is well known to all of us for mukhpaak.
Vd. Pritam Bharat Veer:  Arjun sal, Khadir, Babbul sal, Vishwa, Abhaya, Musta, Vidang, Lodhra, Mayfal Everything 50 -50 grams. Saindhav 250gm
Dr. Anjum: Licorice powder mixed with honey can be applied locally for mouth ulcers . licorice can be used both external and internal , avoid excess intake of pitta prakopa aahar .
Vd. Gurumahantesh: To this eucalyptus oil and karpoor can be added. I think it'll be appropriate.
Vd. Hemant k shah: Nisha amalaki tab which company(brand name)
Dr. Bhavini Raja:Company name - amrita drugs
Tab. Nisa aamlaki
Dr. Anjum : Nisha amalaki is nothing but equal parts of amalaki and turmeric mixed together.
------------------------------------------------
Compiled by - Dr. Dhruti Kagrana


Wednesday, January 24, 2018

Suryavart, Ardhavbhedak - different kind of Shirahshul management by #Ayurveda

Views shared by several Ayurveda professionals and non-Ayurveda people in discussion group:
Disclaimer:
All views shared here are only for knowledge. This information doesn’t have any scientific validation. Various doctors and non-medicos have shared their views and experiences in this discussion. Please do not try any of the suggestions described here, without prior consult from your regular, qualified doctor. Dr. Prerak Shah and no other person is responsible for any unwanted effects, side effects or contra-indications in your health. Thank you.
(Any ayurveda or medical doctor, If you like this activity, and wants to be a part of this chat discussion on whatsapp, please send in your request by email to admin@ayulink.com Thank you.)
<><><><><><><><><><><><><><><><><><><><><><><><><><><><><> 
Next topic for discussion: Suryavart, Ardhavbhedak - different kind of Shirahshul management by #Ayurveda

Dr Jayesh Patel: In severe Shirahshul for instant result we are using “Gudsunthi" Nasya.
Vd Rameshwar Dhanaji: Please enlighten how much quantity of gud and sunthi to be taken ?
Dr Jayesh Patel: As a single drug we are using “Agtsya pushp churn” (Anubhut chikitsa) 1 tea spoon twice a day with pathyadi kwath.

**********************************************

Ayulink offers fast and assured relief for Migraine.

We have 7 Franchise in Ahmedabad, Palanpur, Junagadh, Valsad, Patan, Mahudha and Pune for the management of Migraine.


***********************************************

Dr Jayesh Patel: Gud is double than suthi. 1 pinch sunthi than gud is doable. Little bit water. Mix it & filter with cloth. Take it for nasy 5-6 drops.
Dr. Sushant Patil: Raktamokshan through Shankh Pradesh also give nice results
Dr. Arvind Shahane: Please explain how do raktamokshan on shankh Pradesh By canula or By needle pin point puncture
Vd. nikul patel: I am using Apamargkshar and Godanti bhasma combination and Pathaydi ghan vati for Shiro Shool
Dr. Arvind Shahane: How much dose of apamargkshar n godanti bhasm
Dr. Sushant Patil: Depends on Dosh sanchay
Branko Markovic: Is it better to use pathaydi kashayam tablets or gana vati?
Dr Jayesh Patel: Sir only godanti bhasm?
Shri Minoo parabia: Not cheaper, but Sutsekhar suvarna yukta works efficiently. Still better if combined with Aswagandha
Ayulink: Yes, I have tried with single Godanti bhasma .
Vd. Jayesh Thakkar: I use Lakshmivilas Naradiya with Sootsekhar Ras (sada) and got good relief in many acute conditions. Regular use of Godanti bhasma, Sirasuladi vajra ras, Pathyaksha dhatryadi Kashaya, nasya gives control in severity and incidence. there is definite relation of digestion and other condition with headache which needs to be considered in treatment.
Dr. Bindiya U Shanghvi: I got good result in migraine with the aamla powder and black munnakka soaked overnight and morning empty stomach to eat and drink
Vd Rameshwar Dhanaji: we do get results with ayu medicines but if migraine is chronic like 5-10 years old then it becomes difficult to control recurrence.Opinion may vary.
Branko Markovic: This is challenging indeed! Any case of chronic migraine slowed like 10 years? And how to approach?
----------------------
Vd. Gurumahantesh: If you suspect headache is due to vata vruddhi Kara ahara vihara then pratimarsha nasya with go ghrita is sufficient. If there is kapha avruta shirashula then one can go for classical nasya with anu taila/ pradhamana nasya with vacha.
Dr. Krishnapriya: For sinusitis I had seen a good result by  prathimarsha nasya with tulsi swarasa and honey daily,before sunrise.
Helga Fuchs: Kapha: local sweda (inhalation) and Nasya with Anutail, in catharr sweda and inhale of special nasal powder in nostrils. Sinusitis needs a lot of rest, special emotional rest. Diet is needed to. Avoid all oily and hard to digesting food. No salad, no row vegetables. If symptoms are gone, go slow back to normal food. A good way to reduce Ama is a decoct of: Cumin, Cardamom, piece of fresh Ginger, Curcuma, 2-3 Nelken? Garlic, Coriander, Cinnamom. 1 Tsp/ each in 2 cups of water/ cook it down of 1 cup. 1 cup of this decoction in morning before breakfast, 1 cup at evening, NOT after 7.pm. Drink it daily, up to the point, that all symptoms are gone, and 14 days more. Most client will lost her overweight to. And be very strict with diet. Do not forget no milk products, no curd etc. no bread. Long lasting Sinusitis and her followed problems will gone. If client is not able to take it on empty stomach then after breakfast. It is also a good way for reducing ama before any panchakarma or oily treatment. But only use it if ama is there. Real ama you can see and smell it.
Dr. Bhavini Raja: Is this decoction useful in aam condition of any disease?
Helga Fuchs: Look for stool of patient. If there is bad smell, mucus, then it is very useful. If sputum of client smells bad, if cough is there and client spit grey blackish hard mucus, like little stones, or secretion of nose smells bad. Only this I see as real Ama. In Sinusitis you can see this easy. Only little more mucus is easy to reduce with anti kapha diet Or boiled hot water with one hot substance.
744: Any kind of headache marma Chikitsa may be selected according to the region affected or by the doshic nature of pain, and the severity of symptoms.  In general, stimulating a marma enhances the flow of prana locally and thereby reduces pain. For mild and short-term conditions, marma therapy alone can be quite effective. Marma  that can be used to treat them by expert vaidhya,an specific marma as a preventative measure removal of existing headache. The most beneficial points for each condition vary,generally the thilartha marma and natachatira marmas are effective in severe cases significantly ,
Vd. Pritam Bharat Veer: Shirashul - Shul is due to Vaat prakop.  Where there is vat prakop shul also present. Shul can exaggerated when kaf or pitta come in path of vata dosh. So when there is pitta prakopak lakshna like amlapitta the shul is Vaat Pittaj Shul. Treat accordingly for vatpradhan  pitta shirashul give vatvidwans along with pittashamak chikitsa. I used to give shirshuladi vJra ras along with praval , duralabha , ananta. When head which is area of Kafa there you can gi e kaf har dravyas like kantakari. Just find out the reason of shirshula  and treat accordingly.
Dr. Sharmila Kulkarni: Used to suggest Pathyadi kashayam for pittaj  shirshool. ie. Ardhavabhedak I have been using it in my practice since last 18 years with almost 100percent results
Ayulink: How long you need to give it? and what is the dose?
Dr. Sharmila Kulkarni: Sir, it is 2teaspoon 3times a day for almost 2weeks depending upon the intensity. Off course diet control is of utmost importance. Some Srunsan like Avipattikar churna can also be given along with.
 Ayulink: I saw a file from a neuro-physician for headache....now modern doctors also recommend to stop tomatoes, curd, pickle, salt, spicy food. When in our Ayurveda practice, we differentiate headache with different dosha imbalance and suggest the diet and activity accordingly. Can we make a general diet control guideline?
Branko Markovic: Did anyone try method by Vaidy Balendu Prakash? His theory is that any migraine or headache can be controlled by regulating pittashaya and yakrut also pitta reducing diet.
Helga Fuchs: Most of headache is due Stress. If feet and toes are cold give strict rest to the Patient and a hot water bottle. And cover your head and forehead with a soft towel. After some time bring the hot water-bottle from toes to the neck. Most headaches will go without problems if you do this early enough. If it is to late maybe vomiting can accrue, but after patient will relax with deep sleep. This is not by migraine; this is by Vata and coldness in head. By migraine avoid coliflower and Broccoli to. To find out about what is the headache, if you cover the head, if headache is due heat, headache get stronger in short time. Then for Shure do not cover the head. Only work with hot water-bottle on cold toes too. Headache due Sinusitis is most due mucus and inflammation. Both need a regulation of agni due lifestyle and food, no way out.
Dr. Supratim Bir: Yesterday in my opd I found a Pt with headache. Flexion of neck was a bit painful. I did Agnikarma in cervical region 4 points & the pain was gone.  Most of the time Dehydration is the main cause for headache. Nasya is always helpful in headaches.
Dr. Siva Kumar: What is the mode of agnikarma? shita or ushna,as ushnakarma lead to further dehydration.
Dr. Navneeth Krishnan: Sir what's the mode of action of agni karma there, is it just the usna Guna countering vata?? Or is there any other reason.
Vd. Dhruti Nirav Bhatt: Shirsh shul we should find dosh prakop . Ahar vihar history and digestion history is main . Because due to constipation Vayu prakop    occurs and indigestion cause Headache. In that case we should give laxative like Erand bhrist haritaki in early morning with warm water ,Pathyadikwath empty stomach . shirahshulari vajra ras   Shankhvati after meal .Shadhbindu oil Nasya . In Pittaj Shirahshul patient has history like burning,nausea and pittprakopak food intake .In that case we should advise  to stop :Fermented Food, Curd, Spicy and food, Bakery items. Sutsekhar Ras empty stomach , Avipattikar ,Shatavari before meal and one laxative like Triphala or swadist virechan gives very good result . Cow ghee Nasya. Kaphaj headache : symptoms like Cold cough, Sinusitis . Food: stop  Cold things like ice-cream, cold drinks, chocolate, Bakery items, chees, Junk food. Advise to take warm water or Sunthi siddh water , warm food items. Sitopaladi, Godanti bhasma with ginger ras and honey , Laxmi vilas ras, Hingwastak after meal gives good results. Nasya with Shadabindu oil ,head massage.
Dr. Jaya Sambhus: Many times shirshul is just symptom we have to find out exact cause or प्रवर व्याधी. suryavart  having pitt raktatmak samprapti , when pt comes in attack go for raktmokshan from ext jugular vein , it works as instant pain reliever n sometime permanent tt too
Dr. Amrish A Shah: Shadbindoo Oil Nasya Give best Results in my Pt
Ayulink: In acute headache:  Do we have any treatment, herb or formula which can work faster like paracetamol? or do we have any medicine cheaper then paracetamol?
Usually paracetamol works in 1 hour and costs max Rs. 2/- . If we can provide faster or cheaper solution, people will definitely come to us in acute condition. I have tried several times with Godanti bhasma. It works. But not in all condition.
Dr. V B. Maheshwari: Cephagrain (charak pharma) nasal drops gives good result in many patients.
Your point is very good but if a patient came to opd in emergency condition then what should I advise. I my opinion we should find some good medicines which we can use as emergency medicine. Rasa kalpana is unique example of this. Rasa aushadhi gives good results and in less time.  Earlier there are many Ayurvedic injections are available but due to lack of research now not a single injection is available in market.
Helga Fuchs: If emergency condition its given, yes, work with ayurvedic possibilities.
Dr. Rajendra Joshi: Cephagrain is useful in migraine
Vd Limesh Khatri: I have seen many patient who doesn’t get relive even after vasograin and tranquilizer too.
Dr. Siva Kumar: I want to know rasausadhas which r effective immediately in shirasula. Among the kastausadhis I have got good relief wt bathua,eranda kalka. Acc. to my view Ayurveda lags behind emergency management as to prescribe drugs for Coma patient, instant relief of headache if the cause is migraine etc., but narcotics drugs can manage it instantly
Vd Limesh Khatri: Shirashuladi vajraras With Ardrak swars. Local application Amrutdhara.
Dr. Siva Kumar: Synergistic effect!
Dr. Bhavini Raja: Oil? Or ointment?
Dr. V B. Maheshwari: Roll on
Dr. Dhara Trivedi: Locally snehan-oil application  and then swedan is also beneficial.
Ayulink: Amrutdhara? what is it? a medicine? or dhara treatment?
Dr. V B. Maheshwari: It's a roll-on for local application.
Dr. Sharmila Kulkarni: For Pittaj shirshool, coconut water shirodhara gives instant results
Vd. Sachin Kadlag: For pittaja shirashula , sutshekhar stat gives results  , many times alone I have found useful in reducing shirashula within 10 to 15 minutes , sometimes along with praval panchamruta has been used in kaphavataja or tridoshaja shirashula pathyadi kwatha or pathyadi ghana vati is found useful in most of the cases and immediate relief within 20 to 25 minutes.local lepan at forehead  with vacha or vishwa or combination of both is found useful kaphavata dominat shirashula.
Dr. Madhuri Patil Chaudhari: In pittaj shir:shool,  Sirolepan with Chandan n Mrugshrung pishti or paste  made by  rubbing the whole part on a slate of Marble or granite stone and made fine. In Vaataj,  Sunthi Vacha kaand, Jaiphal, fine pishti or paste made same way. Kaphaj - Vacha Sunth paste. all made with little lukewarm water n applied whn a little warm. But Nasya works best Anu tel or Panchendriyavardhan oil,  regular use. Suvarn Sutshekhar + Jawahar mohara pishti+ praval panchamrut or Praval pishti chandrputi, all made in2 fine paste with honey repeatedly ingesting by licking like avleh..in Migrain or Ardhavbhedak which has just started. if too much time has passed since presentation of pain, or the pain is tolerated and if it doesn't go away after regular sleep, then strong painkiller injection needed. some pts have very low pain thresholds beyond which no ingested medicine works, only injected 1s work to alleviate pain.
Dr. Supratim Bir:  As it's apta THAT without involvement of Vata the pain is impossible, so I think it's the simple counter action of usna against sheeta guna of Vata. I said Dehydration as one of the  common causes of Headache.  Agnikarma can't lead to Dehydration. Agnikarma is so effective in pain management that I wonder how it has been ignored by the Vaidyas so long!
Dr. Abdulla Mohammad juma: I'm practicing the hejama which I have seen very effective result for treating the headache and other pain in the body. Hejama it is the removing waste and clotted blood from the head and othere area from the body
767:  Any type pain of body. Special migraine headache completely relief. Rakt mokshan vidhi. Hijama cupping therapy.
Ayulink: Ayurveda doctors are not very familiar with cupping therapy. But it is practiced in many part of the world effectively. How cupping therapy can help in migraine or shirshul management?
Dr. Abdulla Mohammad juma: When we do hejama the all toxin it will come out with blood and improve the circulation in the area after that therapy pain will reduced  and most of the time  you will very dark blood come out and patient will get immediate relieve of the headache and also it very useful for un controlled hypertension patient if he is doing every three month on the head.
Dr. V B. Maheshwari: So we should do cupping over affected part only or any where over body?
Dr. Navneeth Krishnan: Sir Does dry cupping also relives headache??
Dr. Gayatri: To kya hum cupping therapy har doshaj prakriti me use kr sakte h because as per sahinta har doshaj prikriti ke lie rakt mokshan ka different type h
Dr. Madhuri Patil Chaudhari: Margavrodhajanya Vaatorakop, if  cause of  pain, works best.  if Dhaatukshayjanya vaat prakopa then we cnt try with good prognosis.,may increase actually. pain n problem. Viddha with hollow needles applies same principle. Viddhagni and better still Agnikarma works best if Dhaatukshayjanya vaat prakop causing pain.
Dr. Navneeth Krishnan: Great explanation mam. Thank you. Mam Please tell y agni karma in dhatukshaya  vata and mode of action ?
Dr. Amrish A Shah: Apamarg kshar 10mg +Godanti Bhasma 10mg+Yastimadu Powder 100mg give bid dose Results is Good
Vd. Hardik bhatt: Hezama gives very good results but at head area I had not done yet. Any complication sir. Pls guide ...
767: No complications Very safe. If early morning Empty stomach Other wise Nausea vomiting & vertigo giddiness
Anália Meirelles: This is for headache?
Dr. Abdulla Mohammad juma: Dry cupping therapy lt will not give any result for headache and patient has to be stop food and drinking two hours before the procedure and after hejama he has to stop exercise and sex for three days after that patient he will feelings active in all of his body and regarding our Muslim religion profet Mohammed advice us  to do  hejama days of 17,19;21of Arabic calender after middle of the month because there is relation between our humen body and the moon and in this three days our blood will throw maximum waste from our body and other day we can do it but only NBM two hour before hejama .we can  do hejama on the pain area and also we have specific area in the body for each disease sometimes hejama will cured the illness and sometimes patient will get relieve for six month or one year or pain and disease will disappear from patient body, along life.
-------------------------------
Dr. Tejendra Singh: Nasya of Almond oil , head massage with almond oil also helpful in Shirashul. Nasya of cow ghee. Nasya with swarasa of Vitex negundo leaves.
Vd. Avni Kaneria: Headache related to stress - shiro-dhara is best
Vd. Divyakumari solanki: Nasya with goughrita, Pathyadi kwatha
Vd. Sureshbhai Chavda: Ayurveda, however, categorically defines the different headaches, as Vaataj, pittaj, Kaphaj or Sannipataj. Added to that Ardhavbhedak (pain in half head) & suryavarta (pain that increases with rising sun & decreases with setting sun) have been beautifully defined.
Rukshashanadadhyashanatpragwatavashya maithune: I
Vegsandharana yas vyaame:kupitoaanil: II
Kwala: sakafo waardh grihitwa shirsou wali I
Manya bhrushankh karma ksilalatardheshu vednam II
Shashtrashani nibham kuryattibramsoardhavabhedak:” I 
-         Yog Ratnakar- Shirorog.
The meaning of the above stanza is coarse and dry diet, eating up in heavy quantities, taking on the easterly wind in enormous measures, getting drenched up in dew excessive of sexual activities, keeping the call of nature on hold, the wind getting furious by dint of exercises and labour becoming stronger alone or in combination with the cough takes into its grips the ½ portion of the head producing such a terrible pain in the parts as if somebody is slashing the head with a very sharp edged weapon or somebody is churning the head from inside within with a thorny churner. 
Treatment: Pathyadi kwath,shirshuladi vati, godanti, mukta pisti, sutshekhar ras, vatvidhvansh ras, avipatikar churna etc use
 Dr. Vivek D. Shah: 1)Pathyadi ghanvati 2)Sutsekhar ras.. These two drug r enough to cure all type of shirashool. Then after add anupan according to types of shirashool. Anupan dravya makes the difference.
------------------------------------------------
Compiled by: Dr.Dhruti Kagrana


Thursday, January 18, 2018

Understanding of Thyroid (T3, T4 and TSH) according to #Ayurveda

Views shared by several Ayurveda professionals and non-Ayurveda people in discussion group:
Disclaimer:
All views shared here are only for knowledge. This information doesn’t have any scientific validation. Various doctors and non-medicos have shared their views and experiences in this discussion. Please do not try any of the suggestions described here, without prior consult from your regular, qualified doctor. Dr. Prerak Shah and no other person is responsible for any unwanted effects, side effects or contra-indications in your health. Thank you.
(Any ayurveda or medical doctor, If you like this activity, and wants to be a part of this chat discussion on whatsapp, please send in your request by email to admin@ayulink.com Thank you.)
<><><><><><><><><><><><><><><><><><><><><><><><><><><><><> 
Next topic for discussion:Understanding of Thyroid (T3, T4 and TSH) according to #Ayurveda
Vd. Jayesh Thakkar: Thyroid effects seen at Dosha-Dhatu-Agni level commonly.
Hyperthyroid: Vata-Pitta vriddhi, Rasa Dhatu paka, Tiksna Agni
Hypothyroid: Kapha vridhi, Mamsa-Meda dushti, Manda-agni

**********************************************

Ayulink offers
Chemical Free Beauty Treatments
We recommend enjoying our “Hair-Spa”
(removes dryness & improves luster)

***********************************************

Dr. Arvind Shahane: Hypo thyroid is like our kafaj ajirn. I had treated like this theory my pts have completely relief. No need thyroxin since 1.5 yrs all pts
Ayulink: some scholars count Thyroid in shotha and some says thyroid is agni dushti
Dr Jayesh Patel: Some says it's atya-agni ...So basically it's related with agni duahti
Ayulink: View of Gopakumar sir on Thyroidism and Ayurved
Thyroid --- कफ स्थान (Place of Kapha)
Hypothyroidism --- वात आणि कफ दोष
Hyperthyroidism --- वात आणि पित्त दोष
Hypothyroidism
कफहर आणि मेदोहर उपचार आवश्यक वमन अत्यंत आवश्यक .
कफाचे मंद , शीत गुरु गुण शरीरात वाढतात

उपचार --
Step I (अग्नी दीपन, आम पाचन, क्लेद शोषण)
.षडधरण चूर्ण + पाचनामृत काढा
. हंसपद्यादी कषाय
. चित्रकादी वटी
. शिवा गुटिका
Step II (संग निर्हरण – Removal of Obstruction)
. पुनर्नवादी काढा
. पुनर्नवा मंडूर
. अष्टवर्ग कषाय
. वरुनादी कषाय
. गुग्गुळ तिक्तक कषाय (भूक कमी असेल तर देवू नये.)
. असणादी क्वाथ
. गायात्र्यादी क्वाथ (खादिरादी क्वाथ)
. कांचनार गुग्गुळ
. नवक गुग्गुळ
१०. सिंहनाद गुग्गुळ
११. नस्य अणुतेल, षडबिंदू तेल
Step III --- रसायन उपचार
.चित्रक रसायन
. भल्लातक रसायन
. शिलाजित रसायन
. लसून रसायन (क्षीरपाक)
आहार ---
कुळीथ युष
मुग डाळ युष
पंचकोल पेया
Hyperthyroidism
दोष वात पित्त वृद्धी
धातुगत अग्नी वृद्धी झाल्यामुळे वरील अवस्था निर्माण होते.
पित्ताचे उष्ण तीक्ष्ण गुण वाढलेले असतात.
रस क्षय होवून धातुपाक होतो.

उपचार ---
बृहण उपचार आवश्यक .
तिक्त रस युक्त वनस्पती वापराव्या.
STEP I (वातपित्तहर)
विरेचन आवश्यक त्रिवृत्त लेह वापरावा (स्निग्ध विरेचन).
STEP II (धातुगत आम पाचन)
.शतावर्यादी क्वाथ
.शतावरी क्षीरपाक
.तिक्तक क्वाथ
.गुदुच्यादी क्वाथ
.महामंजीष्ठादी काढा
STEP II (बृहण)
.कारस्कर घृत
.तिक्तक घृत
.दाडीमादी घृत
.पंचगव्य घृत
STEP III (रसायन उपचार)
.गुडूची क्षीर
.गुडूची सत्व
.अश्वगंधा क्षीर
.शतावरी क्षीर
.आमलकी अवलेह
•          द्वौ श्लेष्मभुवौ .शा..११
•          श्लेष्मभुवौ कण्ठस्य पार्श्वयोर्व्यवस्थितौ कठिनौ भागौ चक्रपाणि
Thyroid disorders
•          कफस्थान
•          श्लेष्मणानुगता वृद्धिः
•          सर्वैव वृद्धिः प्रायोऽतिसन्तर्पणनिमित्तावाच्छ्लेष्मणानुगता .सं.सू.११.१३
•          व्यान- धातुव्यूहन
•          .... वाय्वात्मकं...... धातुव्यूहनम् ....शा..१२
•          धातुव्यूहनं धातुरचना धातुवहनं | चक्रपाणि
•          मारुतो वा धातुपोषकरसवाही व्यानरूपः चक्रपाणि .सू.२८.
•          रस- कफ संबंध
•          रस- सर्वधातुपोषण
•          कण्ठ- रक्त संबंध
•          बृहत्त्व- मांसमेद
•          मेदोवृद्धिः
•          सार्वदेहिक शुक्र, ओज --> नूतनोत्पत्ति
Hypothyroidism
•          रसदुष्टि
•          अग्नि-पचनविकृति-->रसदुष्टि
•          रसदुष्टि--> रक्तदुष्टि
•          रसदुष्टि--> रजोदुष्टि
•          रसदुष्टि--> विकृत साम मेदोवृद्धि
•          मेद एव उपचीयते तथा इतरे धातवः
•          विकृत साम मेदोवृद्धि--> अन्यधातुपोषण रुद्ध
•          प्रारंभे अस्थि-मज्जा-शुक्रक्षय ,पश्चात् अन्यधातु
•          सार्वदेहिक शुक्र, ओजक्षय,
•          मानस विकृति, धी-धृति-स्मृतिविकृति
•          साम-विकृत मे्दोवृद्धि-->शैथिल्य, पार्थिवभावदौर्बल्य
•          रक्त-मेद विकृति--> सिरा, कण्डरा, स्नायुविकृति
•          अग्निमान्द्य--> आमनिर्मिति-->स्रोतोरोधजन्य पाण्डु
•          मेदोरोग
•          अजीर्ण
•          आवृते श्लेष्मणोदाने वैवर्ण्यं वाक्स्वरग्रहः||२२४||
•          दौर्बल्यं गुरुगात्रत्वमरुचिश्चोपजायते| .चि.२८
•          अस्वेदो वह्निमान्द्यं लोमहर्षस्तथैव ||२२६||
•          कफावृते समाने स्याद्गात्राणां चातिशीतता| .चि.२८
•          हीनवातस्य तु श्लेष्मा पित्तेन सहितश्चरन्|
•          करोत्यरोचकापाकौ सदनं गौरवं तथा||५३||
•          हृल्लासमास्यस्रवणं पाण्डुतां दूयनं मदम्|
•          विरेकस्य वैषम्यं वैषम्यमनलस्य ||५४||
•          हीनपित्तस्य तु श्लेष्मा मारुतेनोपसंहितः|
•          स्तम्भं शैत्यं तोदं जनयत्यनवस्थितम्||५५||
•          गौरवं मृदुतामग्नेर्भक्ताश्रद्धां प्रवेपनम्|
•          नखादीनां शुक्लत्वं गात्रपारुष्यमेव ||५६|| .सू.१७
ग्रंथाधार रुग्णानुभव यांच्या आधारे 👆
By Vd.Upendra Dixit sir jee  (of Goa) on another group discussion
NIDAANA OF HYPOTHYROIDISM IS NEAR TO TRIDOSHAJA SHOTHA – R S SONI SIR
Dr. Dipa Mehta: Yes thyroid is agni dusthi
Croatia Branko Markovic: Hypothiroidism is seen as "easy" to solve by majority of Vaidya’s, but hyper is not. Please tell us from your experience how to treat hyper successfully. Anybody with good results regarding hyperthiroidism?
Gary Yuen: Has anyone seen hyperthyroidism more common in some people? Some suggest it may be related to eating meat and vegetarianism helps.
Shri Minoo parabia: I don't think the non-vegetarian diet promotes HT.I know of quiet a few Jain patients, strictly vegetarians, are suffering with Hyper thyroidism.  Mental stress, aggravation of bile, loss of appetite following a strict dieting, are the general triggers to precipitate HT. Its my humble observation. Please correct me.
Gary Yuen: In those cases, it could be an excess of milk and ghee.
Dr Jayesh Patel: I have seen some cases are positive during pregnancy & some cases  are after delivery.....
Gary Yuen: There is one study that shows a significantly reduced risk of hyperthyroidism among vegans, those that don't consume any animal products including dairy. Since the cause seems not well understood by modern medicine but seems to perhaps be an autoimmune disease, it may be worth a try.
Shri Minoo parabia: Indeed.
Dr. Bindiya U Shanghvi: Kanchnar gugglu is best for thyroid or not?
Croatia Branko Markovic: Hypo is treated excellent with kanchanar g and Varanadi kashayam. But didn’t find good results with hyper.. with shatavari, guduchi and kaishora g had some results..
P A. Deshpande: Thyroid cancer case has been treated successfully by me. As per naturopathy thyroid diseases are related liver.  If the inputs are not provided  to thyroid glands  its function is affected resulting into hypo or hyper thyroidism. . The cancer case was treated purely with my treatment . No surgery was done as it could have harmed  vocal cord. The treated was topical and oral-
Croatia Branko Markovic: How did you treat it?
Vd Rameshwar Dhanaji: Great please enlighten about medicines .
Shri Minoo parabia: Dr. Deshpande, we appreciate your achievement. Kindly educate us on your findings and the line of treatment. If it is too long to type, please use audio facility on the phone.
P A. Deshpande: The case of thyroid cancer which I successfully cured was of one female age  51 years  and she was a classical singer. When diagnosed as cancer she went in depression because the surgery could damage vocal cord. For a singer it is more than a life. She was  from Mumbai but had arrangement to stay in Pune. As like Prostate cancer the thyroid gland in cancer enlarges and create obstruction on food pipe , resparatory track  with loss of speech also. The enlargement may deshape neck also. The temp. Of gland rises  significantly due to growth of tumour. Fortunately it was on external area of gland. As a primary part of treatment  , colon cleansing for ten days was done to remove toxins.  Simulteniously  topical and oral treatment was also started as under. All around neck massage with wheat grass juice ( fully pure extracted without adding water. )  then oil prepared from juice . Then cotton packs soaked in same juice were wrapped around neck. Encircled ice pack covered in cotton was applied above it. This was kept for one hour then ice pack was removed.  But soaked packs wrapped around neck were retained and removed after eight hours. The same process was repeated for another eight hours. By using fresh packs. Orally also 4 tsp of juice was given every three hours. The was hold in mouth for 10 - 15 minutes and it was drunk. This was done six times a day. In diet she was totally on fruit / veg juices  coconut water and soup of sprouted Moong and methi seeds.  Just in three weeks the regional temp. Of gland settled to normal. The redishness on neck and wrinkles disappeared with speech improvement.  In three months  the selling reduced to 50 %  with saliva secretion and speech clarity.  A scan after nine months did not show any tumour but slightly thickening was seen. This also gone after fifteen months.  After couple of years she started singing and lived very happy life. Now how this has happened , I mean what is mechanism in the whole process .Every part of body say .muscles tissues. Glands etc needs nutriants and phyto chemicals for proper function. Liver process and. Through metabolism  the supply is done as per directions of pitutory through a signaling system operated through receptor or inlets.  When the supply chain do not work efficiently the organ muscle tissues gland area starved. It's temperature rises due to extra stress to procure and inspire of it when fails to procure  the damages takes place.resulting into cancer. . Oxygen molecules ares destroyed and its place is taken by hydrogen. The further changes are fermentation  , fungal formation then yeast molds and carsinogene .This patient was singer and there was excessive strain on oral organs including thyroid. Now how it was corrected ? 1 )  colon cleansing removed toxins from gastric track and veg juices  bottle gourd cocumber  reduced load on liver.increasing its functional capacity  to cater needs of bio chemicals.  Fruits / veg juices  bridged up nutritional imbalance.  alkaline  diet reduced toxicity. The wheat grass juice has anti cancer components such as Ltryle B 17 . Powerful antioxidants like Vit A almost every compound of Vit B  , vit C  and  chlorophyl. The cold topical treatment nutralised gland temperature which is a first stem of cancer conversion chain.  The oil provided lubrication and medication.  The juice it's high power paste provided  nutruants and anti cancerous contents plus chlorophyll  stopped malignant cells mutation giving more space to normal healthy cells. Oral juice treated all affected inner parts to prohibit tumour growth.  Improved health of saliva glands. and vocal cord etc. the chlorophyll releases oxygen and absorbs toxic gases which also play important role in malignant mechanism. Photographs I will put tomorow.  If any clarification needs I will be happy to do.
Croatia Branko Markovic: Wow amazing 🙏 Thank you for your effort to write everything! Here in EU quite some number of people prescribe wheat grass but in powder form. Will that be also good enough and what should be the doses in such hard cases? In croatia we have on the market oils from sprouted wheat. Will this do the job also?
P A. Deshpande: I will reply above questions at the same time would suggest how best it can be. managed by Great ayurveda also. by comparison as well as missing  points too. Every thing is plenty in nature only there is a need to co relate.  Thanks for listening
Croatia Branko Markovic: Thank you. It is always good to use every possible way to treat person regarding any system.. wheat is world wide available so that is also why it is interesting. People here use it a lot!
 Vd. Hemant k shah: Respected sir  as per my opinion thyroid  is kuf+ ajirna  so I give lakhaniya dravya like arogya vardhani vati +kanchanar guglu+triphla
Vd. Dhruti Nirav Bhatt: Hypothyroidism  is Kaphaj dusti ,Mandagni,Ras dhatu dusti, we can find symptoms of Pandu in those patients. Pathyapathya helps a lot. Madoharvidangadi loh,Kanchnar guggul, Varunadi and Dashmool Kwath have good results. Trifla for laxative. Pranayam and yogasan very effective role, PANCHKARMA therapy like Vaman and Basti give good results.
Dr. Amrish A Shah: I Had treated like this theory my pts have relief trikatu choorn Punarnava mandur kanchnar gugal Vrunadi Qwath Arogya Varthini Ras giloy tab Churna.
------------------------------------------------
compiled by - Dr. Dhruti Kagrana


Management of Stomatitis (Mukhpaka)

Views shared by several Ayurveda professionals and non-Ayurveda people in discussion group:   Disclaimer: All views shared here are on...